Cart summary

You have no items in your shopping cart.

EPOR Rabbit Polyclonal Antibody

SKU: orb579090

Description

Rabbit polyclonal antibody to EPOR

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EPOR
TargetEPOR
Protein SequenceSynthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EPO-R

Similar Products

  • EpoR (phospho Tyr368) rabbit pAb Antibody [orb768012]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • EpoR rabbit pAb Antibody [orb768013]

    ELISA,  IF,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • EPOR Rabbit Polyclonal Antibody [orb500789]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • EPOR Antibody [orb1311919]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • EpoR (phospho Tyr426) rabbit pAb Antibody [orb764413]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EPOR Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

EPOR Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

EPOR Rabbit Polyclonal Antibody

Rabbit Anti-EPOR Antibody, Catalog Number: orb579090, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

EPOR Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

EPOR Rabbit Polyclonal Antibody

WB Suggested Anti-EPOR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000112

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

EPOR Rabbit Polyclonal Antibody (orb579090)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry