You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| Molecular Weight | 4202.66 |
| Protein Sequence | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Exendin-4 (3-39) amide [orb1140522]
> 95% by HPLC
3992.4 Da
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
1 mgAvexitide [orb1296372]
99.65% (May vary between batches)
133514-43-9
3369.76
C149H234N40O47S
1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Request a Document
Protocol Information
Exendin 3 (orb2694980)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review