You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | GCGR |
|---|---|
| CAS Number | 196109-31-6 |
| MW | 3992.47 |
| Purity | ≥95% |
| Formula | C176H272N46O58S |
| Protein Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Exendin-4 (3-39) amide [orb1140522]
> 95% by HPLC
3992.4 Da
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
GCGR
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide