Feline CCL17 protein

SKU: orb1291248

Description

The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Feline
Target	CCL17
Molecular Weight	8.5 kDa
Protein Length	75.0
Protein Sequence	ARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKDAIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQE (75)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CCL17

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols