Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FEN1 Rabbit Polyclonal Antibody

SKU: orb579666

Description

Rabbit polyclonal antibody to FEN1

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetFEN1
Protein SequenceSynthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH
Molecular Weight42kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MF1, RAD2, FEN-1

Similar Products

  • FEN1 Rabbit Polyclonal Antibody [orb614113]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • FEN-1 rabbit pAb Antibody [orb765211]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • FEN1 Rabbit Polyclonal Antibody [orb627006]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • FEN1 Antibody [orb685502]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • FEN1 Rabbit Polyclonal Antibody [orb213924]

    IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 30 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FEN1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

FEN1 Rabbit Polyclonal Antibody

WB Suggested Anti-FEN1 Antibody, Positive Control: Lane 1: hFEN1 (1-336), Lane 2: uninduced BL21, Lane 3: 2h induced BL21, Lane 4: overnight induced BL21, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

FEN1 Rabbit Polyclonal Antibody

WB Suggested Anti-FEN1 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. FEN1 is supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004102

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FEN1 Rabbit Polyclonal Antibody (orb579666)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry