Ferret IFN Beta protein

SKU: orb1215731

Description

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)) (Gene ID: 101679100).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Ferret
Target	IFN Beta
Molecular Weight	19.8 kDa
Protein Length	166.0
Protein Sequence	AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IFN Beta

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols