Cart summary

You have no items in your shopping cart.

GAPDH Rabbit Polyclonal Antibody

SKU: orb577464

Description

Rabbit polyclonal antibody to GAPDH

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH
TargetGAPDH
Protein SequenceSynthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
Molecular Weight36 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G3PD, GAPD, HEL-S-162eP

Similar Products

  • GAPDH Rabbit Polyclonal Antibody (Loading Control) [orb500826]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Hamster

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    1 ml, 100 μl, 500 μl, 200 μl
  • GAPDH antibody [orb555879]

    ICC,  IHC-P,  IP,  WB

    Bacteria, Bovine, Canine, Drosophila, E. coli, Fish, Gallus, Hamster, Human, Insect, Mammal, Monkey, Mouse, Other, Plant, Porcine, Rabbit, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GAPDH Rabbit Polyclonal Antibody [orb577465]

    WB

    Canine, Equine, Guinea pig, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GAPDH Rabbit Polyclonal Antibody [orb389477]

    FC,  ICC,  IF,  IHC,  WB

    Gallus, Human, Monkey, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GAPDH Rabbit Polyclonal Antibody [orb584046]

    WB

    Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GAPDH Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 84 kDa.

GAPDH Rabbit Polyclonal Antibody

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

GAPDH Rabbit Polyclonal Antibody

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. GAPDH is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

GAPDH Rabbit Polyclonal Antibody

Lanes: 1. 50 ug NIH3T3 cytosolic extract 2. 50 ug NIH3T3 cytosolic extract 3. 50 ug NIH3T3 cytosolic extract 4. 50 ug NIH3T3 cytosolic extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:30000, Gene Name: GAPDH.

GAPDH Rabbit Polyclonal Antibody

Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GAPDH Rabbit Polyclonal Antibody

Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GAPDH Rabbit Polyclonal Antibody

WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

GAPDH Rabbit Polyclonal Antibody

WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002037

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GAPDH Rabbit Polyclonal Antibody (orb577464)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry