Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GATA2 Rabbit Polyclonal Antibody

SKU: orb573929

Description

Rabbit polyclonal antibody to GATA2

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GATA2
TargetGATA2
Protein SequenceSynthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
Molecular Weight51 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DCML, IMD21, NFE1B, MONOMAC

Similar Products

  • GATA-2/3 rabbit pAb Antibody [orb768355]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl
  • GATA2 Rabbit Polyclonal Antibody [orb101321]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GATA2 Rabbit Polyclonal Antibody [orb669087]

    ELISA,  FC,  ICC,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GATA-2 (phospho Ser401) rabbit pAb Antibody [orb768352]

    ELISA,  WB

    Human, Monkey

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • GATA-2/3 (Acetyl Lys336/304) rabbit pAb Antibody [orb771323]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GATA2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

GATA2 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

GATA2 Rabbit Polyclonal Antibody

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

GATA2 Rabbit Polyclonal Antibody

Human Liver

GATA2 Rabbit Polyclonal Antibody

Lane 1: 30 ug mouse liver lysate, Lane 2: 30 ug mouse N2a cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: GATA2.

GATA2 Rabbit Polyclonal Antibody

WB Suggested Anti-GATA2 antibody Titration: 1 ug/ml, Sample Type: Human K562.

GATA2 Rabbit Polyclonal Antibody

WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: K562 cell lysate, GATA2 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_116027

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GATA2 Rabbit Polyclonal Antibody (orb573929)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 6,890.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry