GATA6 Rabbit Polyclonal Antibody

SKU: orb573932

Description

Rabbit polyclonal antibody to GATA6

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 4

Tested Applications	IF, IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human GATA6
Target	GATA6
Protein Sequence	Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Molecular Weight	60kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ASD9, AVSD5, PACHD

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Rabbit Anti-GATA6 Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.

The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.

WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

GATA6

UniProt

Q92908

RefSeq (Protein):NP_005248

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_005248

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Immunofluorescence

View Protocol

Find More Protocols