You have no items in your shopping cart.
GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb FL490 Conjugate Antibody
SKU: orb3166832
Description
Images & Validation
−
| Tested Applications | ICC, IHC |
|---|---|
| Dilution Range | IHC: 1:250-1:500; ICC: 1:500 |
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Antibody Type | Recombinant Antibody |
|---|---|
| Host | Gallus |
| Clonality | Recombinant |
| Isotype | IgY |
| Clone No. | L21/32 |
| Immunogen | Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli |
| Target | GluA2/GluR2 glutamate receptor |
| Molecular Weight | 90 kDa |
| Purification | Purified by affinity chromatography |
| Conjugation | FL490 |
Storage & Handling
−| Storage | Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | 1X PBS, 0.05% Sodium Azide pH 7.4 |
| Concentration | 0.5 mg/mL |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
GluA2/GluR2 glutamate receptor
UniProt
UniProt Details
− No UniProt data available
Protocol Information
IHC
Immunohistochemistry
ICC
Immunocytochemistry