You have no items in your shopping cart.
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| Target | GCCR |
|---|---|
| CAS Number | 62340-29-8 |
| MW | 4421.92 |
| Purity | ≥95% |
| Formula | C192H295N59O60S |
| Protein Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNI |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
GCCR
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Lead Time: please enquire