Cart summary

You have no items in your shopping cart.

GNAS Rabbit Polyclonal Antibody

SKU: orb330252

Description

Rabbit polyclonal antibody to GNAS

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
TargetGNAS
Protein SequenceSynthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
Molecular Weight46 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AHO antibody, anti C20orf45 antibody, anti GNAS1 antibody, anti GPSA antibody, anti GSA antibody, anti GSP antibody, anti MGC33735 antibody, anti PHP1A antibody, anti PHP1B antibody, anti POH antibody, anti dJ309F20.1.1 antibody, anti dJ806M20.3.3 antibody, anti NESP antibody, anti PHP1C antibody

Similar Products

  • GNAS Rabbit Polyclonal Antibody [orb330253]

    IHC,  WB

    Bovine, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GNAS complex locus Antibody [orb556837]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GNAS Rabbit Polyclonal Antibody [orb6103]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Sheep, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GNAS Rabbit Polyclonal Antibody [orb330201]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GNAS Rabbit Polyclonal Antibody [orb627410]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GNAS Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around 111 kDa.

GNAS Rabbit Polyclonal Antibody

Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

GNAS Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

GNAS Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

GNAS Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

GNAS Rabbit Polyclonal Antibody

Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

GNAS Rabbit Polyclonal Antibody

Lane 1: INS1 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: GNAS.

GNAS Rabbit Polyclonal Antibody

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human Pancreas, Antibody Concentration: 5 ug/mL.

GNAS Rabbit Polyclonal Antibody

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell, lysate, sGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000507

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GNAS Rabbit Polyclonal Antibody (orb330252)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry