GOLGB1 Rabbit Polyclonal Antibody

SKU: orb325275

Description

Rabbit polyclonal antibody to GOLGB1

Research Area

Cell Biology

Images & Validation

−

Item 1 of 8

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGB1
Target	GOLGB1
Protein Sequence	Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Molecular Weight	376 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti GCP antibody, anti GCP372 antibody, anti GIANTIN antibody, anti GOLIM1 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 4 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with orb325275 at 5 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, GOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B.

Quick Database Links

Gene Symbol

GOLGB1

UniProt

Q14789

RefSeq (Protein):NP_004478

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004478

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols