GRIA2 Rabbit Polyclonal Antibody

SKU: orb592804

Description

Rabbit polyclonal antibody to GRIA2

Research Area

Signal Transduction

Images & Validation

−

Item 1 of 2

Tested Applications	IHC
Reactivity	Mouse
Predicted Reactivity	Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Target	GRIA2
Protein Sequence	Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
Molecular Weight	99kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse Gut Tissue, Primary Dilution: 20 ug/ml and 4 ug/ml, Secondary (Goat Anti-Rabbit Cy3) Dilution: 1:1500.

Quick Database Links

Gene Symbol

GRIA2

UniProt

P42262

RefSeq (Protein):NP_000817

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000817

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

IHC

Immunohistochemistry

View Protocol

Find More Protocols