Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRSF1 Rabbit Polyclonal Antibody

SKU: orb324854

Description

Rabbit polyclonal antibody to GRSF1

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRSF1
TargetGRSF1
Protein SequenceSynthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ13125 antibody

Similar Products

  • GRSF1 Rabbit Polyclonal Antibody [orb738385]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GRSF1 Rabbit Polyclonal Antibody [orb324853]

    WB

    Bovine, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GRSF1 Polyclonal Antibody [orb3150357]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GRSF1 Rabbit Polyclonal Antibody (HRP) [orb2125733]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • GRSF1 Rabbit Polyclonal Antibody (FITC) [orb2125734]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRSF1 Rabbit Polyclonal Antibody

GRSF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb324854 with 1:200 dilution. Western blot was performed using orb324854 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: GRSF1 IP with orb324854 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

GRSF1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

GRSF1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

GRSF1 Rabbit Polyclonal Antibody

WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002083

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GRSF1 Rabbit Polyclonal Antibody (orb324854)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry