Cart summary

You have no items in your shopping cart.

HIPK2 Rabbit Polyclonal Antibody

SKU: orb574278

Description

Rabbit polyclonal antibody to HIPK2

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
TargetHIPK2
Protein SequenceSynthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Molecular Weight120kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PRO0593

Similar Products

  • HIPK2 Rabbit Polyclonal Antibody [orb100602]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • HIPK2 Rabbit Polyclonal Antibody [orb215143]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • HIPK2 polyclonal antibody [orb645376]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • HIPK2 Rabbit Polyclonal Antibody (Biotin) [orb2139580]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • HIPK2 Rabbit Polyclonal Antibody (HRP) [orb2139581]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HIPK2 Rabbit Polyclonal Antibody

HIPK2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574278 with 1:200 dilution. Western blot was performed using orb574278 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: HIPK2 IP with orb574278 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

HIPK2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

HIPK2 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

HIPK2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes & intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

WB Suggested Anti-HIPK2 Antibody Titration: 0.06 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

HIPK2 Rabbit Polyclonal Antibody

WB Suggested Anti-HIPK2 Antibody Titration: 0.1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_073577

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

HIPK2 Rabbit Polyclonal Antibody (orb574278)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry