Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HK2 Rabbit Polyclonal Antibody

SKU: orb330743

Description

Rabbit polyclonal antibody to HK2

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HK2
TargetHK2
Protein SequenceSynthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Molecular Weight102kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp686M1669 antibody, anti HKII antibody, anti HXK2 antibody

Similar Products

  • SPHK1 Rabbit Polyclonal Antibody [orb763192]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • KIF2A Rabbit Polyclonal Antibody [orb763127]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • KV1.5 rabbit pAb Antibody [orb765563]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Hexokinase II Rabbit Polyclonal Antibody [orb1349]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Hexokinase 2 Rabbit Polyclonal Antibody [orb5445]

    WB

    Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HK2 Rabbit Polyclonal Antibody

Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Small Intestine (M-IN), Antibody concentration: 1 ug/ml.

HK2 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HK2 antibody (orb330743).

HK2 Rabbit Polyclonal Antibody

Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: HK2.

HK2 Rabbit Polyclonal Antibody

Rabbit Anti-HK2 Antibody, Catalog Number: orb330743, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HK2 Rabbit Polyclonal Antibody

WB Suggested Anti-HK2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, HK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000180

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HK2 Rabbit Polyclonal Antibody (orb330743)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry