Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HNRPA0 Rabbit Polyclonal Antibody

SKU: orb324888

Description

Rabbit polyclonal antibody to HNRNPA0

Research Area

Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsICC, IF, IP, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Porcine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
TargetHNRNPA0
Protein SequenceSynthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Molecular Weight34kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HNRPA0 antibody

Similar Products

  • HNRNPA0 Rabbit Polyclonal Antibody [orb627755]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • HNRNPA0 Polyclonal Antibody [orb3150109]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • hnRNP A0 Rabbit Polyclonal Antibody [orb378105]

    IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • HNRNPA0 polyclonal antibody [orb641800]

    IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • HNRPA0 Rabbit Polyclonal Antibody (HRP) [orb2125061]

    IF,  IHC,  IP,  WB

    Bovine, Canine, Human, Porcine

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HNRPA0 Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPA0 Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

HNRPA0 Rabbit Polyclonal Antibody

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPA0 ppt. k562 sample, IP Antibody: HNRPA0, Amount of IP Antibody, Primary Antibody: HNRPA0, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.

HNRPA0 Rabbit Polyclonal Antibody

Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.

HNRPA0 Rabbit Polyclonal Antibody

Rabbit Anti-HNRNPA0 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

HNRPA0 Rabbit Polyclonal Antibody

Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

HNRPA0 Rabbit Polyclonal Antibody

Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

HNRPA0 Rabbit Polyclonal Antibody

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green, Gene Name: HNRPA0.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006796

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

HNRPA0 Rabbit Polyclonal Antibody (orb324888)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 6,890.00
Free Secondary Antibody Gifts (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry