Cart summary

You have no items in your shopping cart.

HNRPH1 Rabbit Polyclonal Antibody

SKU: orb326259

Description

Rabbit polyclonal antibody to HNRNPH1

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsICC, IF, IP, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
TargetHNRNPH1
Protein SequenceSynthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp686A15170 antibody, anti HNRPH antibody, anti hnRNPH antibody, anti HNRPH1 antibody

Similar Products

  • HnRNP H/HNRNPH1 Rabbit Polyclonal Antibody [orb389415]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • hnRNP H rabbit pAb Antibody [orb765425]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HNRNPH1 Antibody [orb666917]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl
  • HNRNPH1 Rabbit Polyclonal Antibody [orb627762]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • HNRNPH1/HNRNPH2 Antibody [orb673110]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HNRPH1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

HNRPH1 Rabbit Polyclonal Antibody

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPH1 ppt. k562 sample, IP Antibody: HNRPH1, Amount of IP Antibody, Primary Antibody: HNRPH1, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

HNRPH1 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

HNRPH1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

HNRPH1 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

HNRPH1 Rabbit Polyclonal Antibody

IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/mL.

HNRPH1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

HNRPH1 Rabbit Polyclonal Antibody

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue HNRNPH1: Green, Gene Name: HNRPH1.

HNRPH1 Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005511

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

HNRPH1 Rabbit Polyclonal Antibody (orb326259)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry