Cart summary

You have no items in your shopping cart.

HSPA1L Rabbit Polyclonal Antibody

SKU: orb582161

Description

Rabbit polyclonal antibody to HSPA1L

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Mouse, Porcine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
TargetHSPA1L
Protein SequenceSynthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Molecular Weight70kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HSP70T, hum70t, HSP70-1L, HSP70-HOM

Similar Products

  • HSPA1L Rabbit Polyclonal Antibody [orb1939996]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSP70L rabbit pAb Antibody [orb765450]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HSPA1L Antibody [orb675631]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • HSPA1L Antibody [orb627855]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • HSPA1L Antibody [orb340789]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HSPA1L Rabbit Polyclonal Antibody

Sample Type: 1. Lamprey CNS (20 ug), 2. Rat Brain Lysate (20 ug), Primary dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary dilution: 1:4000.

HSPA1L Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.

HSPA1L Rabbit Polyclonal Antibody

Sample Tissue: Human MDA-MB-435s, Antibody dilution: 1.0 ug/ml.

HSPA1L Rabbit Polyclonal Antibody

HSPA1L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582161 with 1:200 dilution. Western blot was performed using orb582161 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: HSPA1L IP with orb582161 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

HSPA1L Rabbit Polyclonal Antibody

Rabbit Anti-HSPA1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

HSPA1L Rabbit Polyclonal Antibody

WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005518

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HSPA1L Rabbit Polyclonal Antibody (orb582161)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry