Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HSPA1L Rabbit Polyclonal Antibody

SKU: orb582161

Description

Rabbit polyclonal antibody to HSPA1L

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Mouse, Porcine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
TargetHSPA1L
Protein SequenceSynthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Molecular Weight70kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HSP70T, hum70t, HSP70-1L, HSP70-HOM

Similar Products

  • HSPA1L Rabbit Polyclonal Antibody [orb1939996]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSPA1L Antibody [orb675631]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • HSPA1L Rabbit Polyclonal Antibody [orb627855]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • HSPA1L Rabbit Polyclonal Antibody [orb2955246]

    ELISA,  IHC,  WB

    Bacteria, Bovine, Canine, Human, Monkey, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • HSP70 Rabbit Polyclonal Antibody [orb256610]

    IHC,  WB

    Bovine, Canine, Human, Monkey, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HSPA1L Rabbit Polyclonal Antibody

Sample Type: 1. Lamprey CNS (20 ug), 2. Rat Brain Lysate (20 ug), Primary dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary dilution: 1:4000.

HSPA1L Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.

HSPA1L Rabbit Polyclonal Antibody

Sample Tissue: Human MDA-MB-435s, Antibody dilution: 1.0 ug/ml.

HSPA1L Rabbit Polyclonal Antibody

HSPA1L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582161 with 1:200 dilution. Western blot was performed using orb582161 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: HSPA1L IP with orb582161 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

HSPA1L Rabbit Polyclonal Antibody

Rabbit Anti-HSPA1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

HSPA1L Rabbit Polyclonal Antibody

WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005518

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HSPA1L Rabbit Polyclonal Antibody (orb582161)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry