Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HTR2B Rabbit Polyclonal Antibody

SKU: orb573678

Description

Rabbit polyclonal antibody to HTR2B

Research Area

Pharmacology & Drug Discovery, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIF, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
TargetHTR2B
Protein SequenceSynthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
Molecular Weight54 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

5-HT2B, 5-HT-2B, 5-HT(2B)

Similar Products

  • SR-2B rabbit pAb Antibody [orb766367]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HTR2B Antibody (C-term E423) [orb1938426]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • 5HT2B Receptor Rabbit Polyclonal Antibody [orb155532]

    IF,  IHC-Fr,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • HTR2B Antibody [orb671655]

    ELISA,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Human HTR2B Polyclonal Antibody [orb3149651]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HTR2B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. In addition to the 54 kDa canonical protein, isoforms of 51 kDa and 50 kDa also contain this peptide. Proteins may be lipidated and/or glycosylated as well.

HTR2B Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

HTR2B Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

HTR2B Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

HTR2B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

HTR2B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

HTR2B Rabbit Polyclonal Antibody

Immunofluorescence: 1.3 ug/ml.

HTR2B Rabbit Polyclonal Antibody

WB Suggested Anti-HTR2B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, HTR2B is supported by BioGPS gene expression data to be expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000858

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol

HTR2B Rabbit Polyclonal Antibody (orb573678)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry