You have no items in your shopping cart.
Human CCL4 protein (Active)
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human CCR5 transfected murine BaF3 cells is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 5 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 7.8 kDa |
| Expression Region | 24-92aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human CCL4 protein (Active) [orb359070]
> 96% as determined by SDS-PAGE and HPLC.
7.8 kDa
E.Coli
10 μg, 100 μg, 500 μgRecombinantMIP-1β/CCL4,Human [orb1494680]
> 95% as analyzed by SDS-PAGE and HPLC.
10-19 kDa, observed by reducing SDS-PAGE.
CHO
5 μg, 25 μg, 1 mgRecombinantMIP-1β/CCL4,Human [orb1494792]
> 95% as analyzed by SDS-PAGE and HPLC.
7.6 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
5 μg, 25 μg, 1 mgRecombinant Human C-C motif chemokine 4 protein(CCL4) (Active) [orb1650795]
>96% as determined by SDS-PAGE and HPLC.
7.8 kDa
100 μg, 500 μg, 1 mg, 10 μg, 250 μgRecombinant Human C-C motif chemokine 4 protein(CCL4) (Active) [orb1650796]
>97% as determined by SDS-PAGE and HPLC.
7.8 kDa
20 μg, 100 μg, 500 μg, 1 mg, 5 μg, 250 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CCL4 protein (Active) (orb359069)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
