You have no items in your shopping cart.
Human CSF1 protein
SKU: orb605310
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 19.9 kDa |
| Expression Region | 33-190aa |
| Protein Length | Partial |
| Protein Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Similar Products
−- Item 1 of 1
Human CSF1 protein [orb594716]
Greater than 95% as determined by SDS-PAGE.
26.17 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human CSF1 protein (Active) [orb359033]
> 95% as determined by SDS-PAGE and HPLC.
18.4 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
- Item 1 of 2
Human M-CSF (C-6His) Protein [orb1471781]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
26.17 KDa
Mammalian
50 μg, 10 μg - Item 1 of 1
Human CSF1 protein [orb605309]
Greater than 90% as determined by SDS-PAGE.
58.9 kDa
Yeast
20 μg, 1 mg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of CSF1 was greater than 90% as determined by SEC-HPLC
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CSF1 protein (orb605310)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks