You have no items in your shopping cart.
Human EFNA4 protein
SKU: orb594900
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human EphA7-His at 2μg/ml can bind Human EFNA4-Fc-His, the ED50 of Recombinant Human EFNA4-Fc-His is 1.5190 ug/ml. |
| Tag | C-terminal 6xHis-Fc-tagged |
| Molecular Weight | 44.3 kDa |
| Expression Region | 26-171aa |
| Protein Length | Partial |
| Protein Sequence | LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4
Similar Products
−- Item 1 of 1
- Item 1 of 2
Human EFNA4 Protein, hFc Tag [orb2321394]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.4 kDa after removal of the signal peptide. The apparent molecular mass of EFNA4-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg 
Human EFNA4 protein [orb706931]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgHuman EFNA4 protein [orb391645]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human Ephrin-A4/EFNA4 Protein, Fc & His Tag [orb1551342]
> 80% by SDS-PAGE.
Recombinant Human Ephrin-A4/EFNA4 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Leu26-Gly171) of human Ephrin-A4/EFNA4 (Accession # NP_005218.1) fused with an Fc, 6��His Tag at the C-terminus.
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human EFNA4 protein (orb594900)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks