You have no items in your shopping cart.
Human ICOSLG protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 28.9 kDa |
| Expression Region | 19-258aa |
| Protein Length | Partial |
| Protein Sequence | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Inducible T-Cell Co Stimulator Ligand (ICOSLG) ELISA Kit [orb778334]
Human
0.16-10 ng/mL
0.065 ng/mL
48 T, 96 THuman B7-H2 [orb2995052]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 27.72 KDa. Observed: 40-70 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman B7-H2 Protein, mFc-His Tag [orb689390]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.9 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μgRecombinant Human ICOS ligand (ICOSLG), partial, Biotinylated [orb2658139]
Greater than 95% as determined by SDS-PAGE.
30.7 kDa
Mammalian cell
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human ICOSLG protein (orb705334)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





