You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | IL-13 |
| Molecular Weight | 12.3 kDa |
| Protein Length | 112.0 |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 6
- Item 1 of 2
- Item 1 of 2
Recombinant Mouse IL-13RA2 Protein [orb2992724]
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 63.4 KDa. Observed: 70-110 KDa, reducing conditions
1 mg, 500 μg, 50 μg, 10 μgRecombinant Human IL-13RA1 Protein [orb2994201]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 37.7 KDa. Observed: 55-65 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
IL-13
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL-13 protein (orb1215950)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days