You have no items in your shopping cart.
Human IL36G protein
SKU: orb54523
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Molecular Weight | 45.7 kDa |
| Expression Region | 1-169aa |
| Protein Length | Full Length |
| Protein Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−IL-1-related protein 2
Similar Products
−- Item 1 of 1
Human Interleukin 1 Family, Member 9 (IL1F9) ELISA Kit [orb779986]
Human
15.63-1000 pg/mL
6 pg/mL
96 T, 48 T 
Human IL-36g [orb2994336]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17 KDa. Observed: 14-16 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Human IL36G protein (Active) [orb358994]
> 95% as determined by SDS-PAGE and HPLC.
18.7 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL36G protein (Active) [orb358995]
> 95% as determined by SDS-PAGE and HPLC.
17.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL36G protein [orb594810]
Greater than 95% as determined by SDS-PAGE.
17 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36G.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL36G protein (orb54523)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks