You have no items in your shopping cart.
Human Novel Coronavirus Spike glycoprotein(S) protein
SKU: orb668864
Featured
Active
Description
Research Area
Microbiology
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 μg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 μg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 319-541aa (V483A) |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 27.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human Novel Coronavirus Spike glycoprotein(S) protein [orb668860]
Greater than 90% as determined by SDS-PAGE.
30.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μgHuman Novel Coronavirus Spike glycoprotein(S) protein (Biotin) [orb668865]
Greater than 90% as determined by SDS-PAGE.
54.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μgHuman Novel Coronavirus Spike glycoprotein(S) protein [orb668861]
Greater than 90% as determined by SDS-PAGE.
27.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μgHuman Novel Coronavirus Spike glycoprotein(S) protein [orb668862]
Greater than 90% as determined by SDS-PAGE.
30.2 kDa
Mammalian cell
1 mg, 100 μg, 20 μgHuman Novel Coronavirus Spike glycoprotein(S) protein [orb668863]
Greater than 90% as determined by SDS-PAGE.
27.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

















