Human SARS coronavirus Spike glycoprotein protein

SKU: orb704564

Featured

Description

This Human SARS coronavirus Spike glycoprotein protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Yeast
Biological Origin	Severe acute respiratory syndrome coronavirus (SARS-CoV)
Tag	N-terminal 6xHis-tagged
Expression Region	306-527aa
Protein Length	Partial
MW	27 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

E2 Peplomer protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P59594

UniProt Details

−

No UniProt data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Applications:	ELISA, IF
Reactivity:	Virus
Species/Host:	Human
Clonality:	Monoclonal
Conjugation:	Unconjugated

Applications:	ELISA, IF
Reactivity:	Virus
Species/Host:	Human
Clonality:	Monoclonal
Conjugation:	Unconjugated

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	30 kDa
Source:	Mammalian cell

Applications:	ELISA
Predicted Reactivity:	Virus
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Biotin

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	39 kDa
Source:	Yeast

Human SARS coronavirus Spike glycoprotein protein

Description

Research Area

Images & Validation

Key Properties

Storage & Handling

Alternative Names

Similar Products

Anti-COVID-19 & SARS-CoV S glycoprotein [CR3022] [orb758974]

Anti-COVID-19 & SARS-CoV S glycoprotein [CR3022] [orb758975]

Human SARS coronavirus Spike glycoprotein(S) protein [orb668866]