IL-1 beta polyclonal antibody

SKU: orb1724880

This product can be custom made

Description

Images & Validation

−

Tested Applications	WB
Dilution Range	WB: 1/500-1/1000
Reactivity	Human, Mouse, Rat

Key Properties

−

Antibody Type	Primary Antibody
Host	Rabbit
Clonality	Polyclonal
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Molecular Weight	Calculated MW: 31 kDa; Observed MW: 31 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid in PBS containing 50% glycerol, 0.5% rAlbumin and 0.02% sodium azide, pH 7.3.
Concentration	1mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

IL1B; IL1F2; Interleukin-1 beta; IL-1 beta; Catabolin

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P01584

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols