Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

JUN Rabbit Polyclonal Antibody

SKU: orb573698

Description

Rabbit polyclonal antibody to JUN

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse, Other
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetJUN
Protein SequenceSynthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AP1, p39, AP-1, cJUN, c-Jun

Similar Products

  • Phospho-JNK1 + 2 + 3 (Thr183+Tyr185) Rabbit Polyclonal Antibody [orb10951]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • JNK1+JNK2+JNK3 Rabbit Polyclonal Antibody [orb6259]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • JNK1 + JNK3 Rabbit Polyclonal Antibody [orb10949]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-c-Jun (Ser63) Rabbit Polyclonal Antibody [orb4917]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • JUNB Rabbit Polyclonal Antibody [orb763179]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

JUN Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

JUN Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug sea urchin total embryonic lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa Fluor680, Secondary Antibody dilution: 1:5000, Gene Name: JUN.

JUN Rabbit Polyclonal Antibody

WB Suggested Anti-JUN Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002219

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

JUN Rabbit Polyclonal Antibody (orb573698)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry