Cart summary

You have no items in your shopping cart.

KHSRP Rabbit Polyclonal Antibody

SKU: orb577610

Description

Rabbit polyclonal antibody to KHSRP

Research Area

Cell Biology, Molecular Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human KHSRP
TargetKHSRP
Protein SequenceSynthetic peptide located within the following region: IIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSV
Molecular Weight73kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

p75, FBP2, KSRP, FUBP2

Similar Products

  • KHSRP Rabbit Polyclonal Antibody [orb763126]

    ELISA,  FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • FBP2 rabbit pAb Antibody [orb765209]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • KHSRP Rabbit Polyclonal Antibody [orb628236]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • KHSRP Antibody [orb675549]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • KHSRP Rabbit Polyclonal Antibody [orb577611]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KHSRP Rabbit Polyclonal Antibody

Sample Type: Thyroid Tumor lysates, Antibody Dilution: 1.0 ug/ml.

KHSRP Rabbit Polyclonal Antibody

Rabbit Anti-KHSRP Antibody, Catalog Number: orb577610, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

KHSRP Rabbit Polyclonal Antibody

Rabbit Anti-KHSRP Antibody, Catalog Number: orb577610, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

KHSRP Rabbit Polyclonal Antibody

Rabbit Anti-KHSRP Antibody, Catalog Number: orb577610, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and nucleus in Kupffer cells and sinusoids, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

KHSRP Rabbit Polyclonal Antibody

WB Suggested Anti-KHSRP antibody Titration: 1 ug/ml, Sample Type: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003676

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KHSRP Rabbit Polyclonal Antibody (orb577610)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry