You have no items in your shopping cart.
Mouse Il17a protein
SKU: orb594832
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 0.25-1.25 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 16.2 kDa |
| Expression Region | 22-158aa |
| Protein Length | Partial |
| Protein Sequence | TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
Similar Products
−Mouse Interleukin 17A (IL-17A) Microsample Fast ELISA Kit [orb1806764]
Mouse
3.13-200pg/mL
1.88 pg/mL
48 T, 96 TMouse Interleukin 17A (IL-17A) High Sensitivity ELISA Kit [orb1945908]
Mouse
0.78-50pg/mL
0.41 pg/mL
48 T, 96 TIl17a (NM_010552) Mouse Recombinant Protein [orb3036517]
> 80% as determined by SDS-PAGE and Coomassie blue staining
17.5 kDa
100 μg, 1 mg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Il17a protein (orb594832)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



