You have no items in your shopping cart.
Mouse IL36G protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg. |
| Tag | Tag-Free |
| Molecular Weight | 17.3 kDa |
| Expression Region | 13-164aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse Interleukin 1 Family, Member 9 (IL1F9) ELISA Kit [orb781786]
Mouse
7.82-500 pg/mL
2.9 pg/mL
96 T, 48 TRecombinant Mouse IL-36 gamma Protein [orb2993926]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 90% as determined by SEC-HPLC. (QC verified)
Predicted: 17.3 KDa. Observed: 17 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMouse IL36G (Interleukin-36 gamma) ELISA Kit [orb2647832]
Mouse
15.625-1000pg/ml
9.375pg/ml
48 T, 96 TRecombinant Mouse IL36G/IL-1F9 Protein, N-His [orb2964377]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.28 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Mouse IL36G protein (orb419313)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


