Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FER1L3 Rabbit Polyclonal Antibody

SKU: orb325305

Description

Rabbit polyclonal antibody to MYOF

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3
TargetMYOF
Protein SequenceSynthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
Molecular Weight235 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ36571 antibody, anti FLJ90777 antibody, anti MYOF antibody, anti FER1L3 antibody

Similar Products

  • Myoferlin Rabbit Polyclonal Antibody [orb667382]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl, 30 μl
  • [KO Validated] MYOF polyclonal antibody [orb648168]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • FER1L3 Rabbit Polyclonal Antibody (FITC) [orb2116251]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • FER1L3 Rabbit Polyclonal Antibody (HRP) [orb2116250]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • FER1L3 Rabbit Polyclonal Antibody (Biotin) [orb2116252]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FER1L3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

FER1L3 Rabbit Polyclonal Antibody

WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_038479

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FER1L3 Rabbit Polyclonal Antibody (orb325305)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry