Queen's Awards Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NDUFS1 Rabbit Polyclonal Antibody

SKU: orb330870

Description

Rabbit polyclonal antibody to NDUFS1

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NDUFS1
TargetNDUFS1
Protein SequenceSynthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
Molecular Weight79 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CI-75Kd antibody, anti MGC26839 antibody, anti PRO1304 antibody, anti CI-75k antibody

Similar Products

  • NDUFS1 Rabbit Polyclonal Antibody [orb556883]

    ICC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • NDUFS1 Rabbit Polyclonal Antibody [orb6486]

    IF,  IHC-Fr,  IHC-P

    Canine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NDUFS1 Rabbit Polyclonal Antibody [orb214298]

    IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • NDUFS1 Rabbit Polyclonal Antibody [orb629217]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • NDUFS1 Rabbit Polyclonal Antibody [orb258724]

    ELISA,  IHC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NDUFS1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by acetylation.

NDUFS1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug Human liver, Lane 2: 30 ug Rat liver, Lane 3: 30 ug Mouse (wild-type) liver, Lane 4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver, Lane 5: 30 ug Human muscle, Lane 6: 30 ug Rat muscle, Lane 7: 30 ug Mouse muscle, Primary Antibody dilution: 1:1000, Secondary Antibody: Secondary Antibody dilution: 1:10000, Gene Name: NDUFS1.

NDUFS1 Rabbit Polyclonal Antibody

WB Suggested Anti-NDUFS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Fetal Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004997

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NDUFS1 Rabbit Polyclonal Antibody (orb330870)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry