You have no items in your shopping cart.
OMA1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OMA1 |
| Target | OMA1 |
| Protein Sequence | Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
| Molecular Weight | 60 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−OMA1 Rabbit Polyclonal Antibody [orb312420]
IF, IHC-Fr, IHC-P, WB
Bovine, Equine, Feline, Gallus, Porcine, Rabbit, Zebrafish
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlOMA1 Rabbit Polyclonal Antibody [orb629531]
ELISA, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgOMA1 Rabbit Polyclonal Antibody (HRP) [orb2108681]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
Rabbit
Polyclonal
HRP
100 μlOMA1 Rabbit Polyclonal Antibody (FITC) [orb2108682]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
Rabbit
Polyclonal
FITC
100 μlOMA1 Rabbit Polyclonal Antibody (Biotin) [orb2108683]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: HepG2 cells, Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit TBST with 5% BSA, Secondary dilution: 1:5000.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Lung tumor (T-LU), Antibody concentration: 5 ug/ml.

Lanes: Lane 1: 10 ug human fibroblast mitochondria, Lane 2: 15 ug fish embryo lysate; 6 h post fertilization, Lane 3: 30 ug fish embryo lysate, 6 days, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: OMA1.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Documents Download
Request a Document
OMA1 Rabbit Polyclonal Antibody (orb581846)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





