Cart summary

You have no items in your shopping cart.

PDIA3 Rabbit Polyclonal Antibody

SKU: orb585694

Description

Rabbit polyclonal antibody to PDIA3

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsIHC, IP, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetPDIA3
Protein SequenceSynthetic peptide located within the following region: YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

P58, ER60, ERp57, ERp60, ERp61, GRP57, GRP58, PI-PLC, HsT17083, HEL-S-269, HEL-S-93n

Similar Products

  • ERp57 rabbit pAb Antibody [orb766825]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • ERp57/PDIA3 Rabbit Polyclonal Antibody [orb334504]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ERp57 Rabbit Polyclonal Antibody [orb183430]

    IF,  IHC-Fr,  IHC-P,  WB

    Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PDIA3 Rabbit Polyclonal Antibody [orb626814]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ERp57/PDIA3 Rabbit Polyclonal Antibody [orb76193]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PDIA3 Rabbit Polyclonal Antibody

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA3, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA3.

PDIA3 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PDIA3 is supported by BioGPS gene expression data to be expressed in 721_B.

PDIA3 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

PDIA3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

PDIA3 Rabbit Polyclonal Antibody

IP Suggested Anti-PDIA3 Antibody Positive Control: NT2 CELL/BRAIN TISSUE.

PDIA3 Rabbit Polyclonal Antibody

PDIA3 antibody - C-terminal region (orb585694) validated by WB using Fetal Kidney Lysate at 1.0 ug/ml.

PDIA3 Rabbit Polyclonal Antibody

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

PDIA3 Rabbit Polyclonal Antibody

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PDIA3: Red DAPI:Blue, Gene Name: PDIA3.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005304

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

PDIA3 Rabbit Polyclonal Antibody (orb585694)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry