Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PEMT Rabbit Polyclonal Antibody

SKU: orb578862

Description

Rabbit polyclonal antibody to PEMT

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PEMT
TargetPEMT
Protein SequenceSynthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
Molecular Weight22 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PLMT, PNMT, PEAMT, PEMPT, PEMT2

Similar Products

  • MUC1 Rabbit Polyclonal Antibody [orb4746]

    ICC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MUC1 Rabbit Polyclonal Antibody [orb315622]

    ICC,  IF,  IHC-P,  WB

    Human, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MUC1 Rabbit Polyclonal Antibody [orb578068]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse, Porcine

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • MUC1 Rabbit Polyclonal Antibody [orb402330]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Mucin 1 rabbit pAb Antibody [orb767222]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PEMT Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 84, 83, 82, 71, and 42 kDa.

PEMT Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 2 ug/ml.

PEMT Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: PEMT.

PEMT Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: PEMT.

PEMT Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

PEMT Rabbit Polyclonal Antibody

WB Suggested Anti-PEMT Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_680477

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PEMT Rabbit Polyclonal Antibody (orb578862)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry