You have no items in your shopping cart.
PINK1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Application Notes |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | Synthetic peptide located within the following region: GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP |
| Target | PINK1 |
| Molecular Weight | 63 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PINK1 rabbit pAb Antibody [orb773858]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlPINK1 Rabbit Polyclonal Antibody [orb1499435]
WB
Canine, Equine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PINK1 Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell.
Documents Download
Request a Document
Protocol Information
Filter by Applications
Filter by Species
Nabila Bourebaba 1, Justyna Domagała 2, Lynda Bourebaba 3 Revitalizing equine metabolism: how SHBG improves mitochondrial function and reduces inflammation BMC Vet Res, (2025)
Applications
Reactivity
Bourebaba, Lynda et al. The PTP1B inhibitor MSI-1436 ameliorates liver insulin sensitivity by modulating autophagy, ER stress and systemic inflammation in Equine metabolic syndrome affected horses Front Endocrinol (Lausanne), 14, 1149610 (2023)
Applications
Reactivity
Sikora, Mateusz et al. Bone marrow stromal cells (BMSCs CD45- /CD44+ /CD73+ /CD90+ ) isolated from osteoporotic mice SAM/P6 as a novel model for osteoporosis investigation J Cell Mol Med, (2021)
Applications
Reactivity
PINK1 Rabbit Polyclonal Antibody (orb331223)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






