Cart summary

You have no items in your shopping cart.

Porcine CXCL9 protein

SKU: orb1216281

Description

The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetCXCL9
Molecular Weight12.1 kDa
Protein Length104.0
Protein SequenceTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MIG

Similar Products

  • Porcine CXCL9 ELISA Kit [orb1216595]

    Porcine

    1 set (2 x capture antibody), 1 set (1 x capture antibody)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Porcine CXCL9 protein (orb1216281)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry