Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Porcine CXCL9 protein

SKU: orb1216281

Description

The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetCXCL9
Protein Length104.0
MW12.1 kDa
Purity98%
Protein SequenceTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MIG

Similar Products

  • Porcine CXCL9 ELISA Kit [orb1216595]

    Porcine

    1 set (2 x capture antibody), 1 set (1 x capture antibody)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry