Cart summary

You have no items in your shopping cart.

PPARA Rabbit Polyclonal Antibody

SKU: orb574497

Description

Rabbit polyclonal antibody to PPARA

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human PPARA
TargetPPARA
Protein SequenceSynthetic peptide located within the following region: FTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNI
Molecular Weight52 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PPAR, NR1C1, hPPAR, PPARalpha, PPAR-alpha

Similar Products

  • PPAR alpha Rabbit Polyclonal Antibody [orb15031]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPAR-α Polyclonal Antibody [orb1412440]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PPAR alpha Rabbit Polyclonal Antibody [orb499655]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPAR-α rabbit pAb Antibody [orb769541]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Ppara Rabbit Polyclonal Antibody [orb574921]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PPARA Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

PPARA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

PPARA Rabbit Polyclonal Antibody

WB Suggested Anti-PPARA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: OVCAR-3 cell lysate, PPARA is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

PPARA Rabbit Polyclonal Antibody

WB Suggested Anti-PPARA antibody Titration: 1 ug/ml, Sample Type: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005027

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PPARA Rabbit Polyclonal Antibody (orb574497)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry