PRDM9 Rabbit Polyclonal Antibody

SKU: orb324624

Description

Rabbit polyclonal antibody to PRDM9

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 8

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Human

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
Target	PRDM9
Protein Sequence	Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
Molecular Weight	103kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti PFM6 antibody, anti MSBP3 antibody, anti PRMD9 antibody, anti ZNF899 antibody, anti MEISETZ antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PRDM9 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mL, Positive Control: 293T cells lysate.

Quick Database Links

Gene Symbol

PRDM9

UniProt

Q9NQV7

RefSeq (Protein):NP_064612

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_064612

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols