You have no items in your shopping cart.
PRDM9 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PRDM9 |
| Target | PRDM9 |
| Protein Sequence | Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP |
| Molecular Weight | 103kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PRDM9 Rabbit Polyclonal Antibody [orb2951011]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PRDM9 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mL, Positive Control: 293T cells lysate.
Documents Download
Request a Document
Protocol Information
PRDM9 Rabbit Polyclonal Antibody (orb324624)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review![Anti-PRDM9 [RAB-C370]](/images/pub/media/catalog/product/NewWebsite/35/orb1089950_1.png)
![Anti-PRDM9 [RAB-C370]](/images/pub/media/catalog/product/NewWebsite/35/orb1089950_2.png)
![Anti-PRDM9 [RAB-C370]](/images/pub/media/catalog/product/NewWebsite/35/orb1089950_3.png)
