PUF60 Rabbit Polyclonal Antibody

SKU: orb577766

Description

Rabbit polyclonal antibody to PUF60

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 4

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60
Target	PUF60
Protein Sequence	Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Molecular Weight	58kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

FIR, VRJS, RoBPI, SIAHBP1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rabbit Anti-PUF60 Antibody Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-PUF60 Antibody, Titration: 0.5 ug/ml, Positive Control: Human 293T cell lysate.

WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela. PUF60 is supported by BioGPS gene expression data to be expressed in HeLa.

Quick Database Links

Gene Symbol

PUF60

UniProt

Q9UHX1

RefSeq (Protein):NP_055096

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055096

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols