Rabbit IFN gamma protein

SKU: orb1215705

Description

The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602).

Research Area

Infectious Disease & Virology

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Rabbit
Target	IFN gamma
Molecular Weight	16.9 kDa
Protein Length	144.0
Protein Sequence	QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IFN gamma

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols