RBM10 Rabbit Polyclonal Antibody

SKU: orb573578

Description

Rabbit polyclonal antibody to RBM10

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

−

Item 1 of 8

Tested Applications	IHC-P, WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
Target	RBM10
Protein Sequence	Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Molecular Weight	104 kDa
Purification	Protein A purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is also present at 94 kDa. The protein is modified by phosphorylation.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Rat liver (R-LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

RBM10 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573578 with 1:200 dilution. Western blot was performed using orb573578 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: RBM10 IP with orb573578 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-RBM10 Antibody Titration: 1.4 ug/ml, ELISA Titer: 1:1562500, Positive Control: Daudi cell lysate, RBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.

Quick Database Links

Gene Symbol

RBM10

UniProt

P98175

RefSeq (Protein):NP_005667

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_005667

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Find More Protocols