RBM47 Rabbit Polyclonal Antibody

SKU: orb577838

Description

Rabbit polyclonal antibody to RBM47

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

−

Item 1 of 9

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RBM47
Target	RBM47
Protein Sequence	Synthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
Molecular Weight	64 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

NET18

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. PrimaryAntibody concentration 5 ug/ml.

WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226.

Quick Database Links

Gene Symbol

RBM47

UniProt

A0AV96

RefSeq (Protein):NP_061900

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_061900

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols