Recombinant CCL3 (C-C motif chemokine ligand 3), Human, Animal-Free

SKU: orb1179153

Description

Images & Validation

−

Tested Applications	Cell Culture, ELISA

Key Properties

−

Source	Escherichia coli
Expression System	Escherichia coli
Biological Origin	Human
Biological Activity	Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.
Reactivity	Human
Tag	His-tag at the N-terminus
Protein Sequence	ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA.
Purity	>98% as determined by SDS-PAGE. Ni-NTA chromatography.
Endotoxins	<0.1 EU per 1 μg of the protein by the LAL method.

Storage & Handling

−

Storage	Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Form/Appearance	Lyophilized
Buffer/Preservatives	The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
Reconstitution	It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

MIP-1a: Macrophage Inflammatory Protein-1α, LD78α

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

NCBI Gene ID

6348

NCBI Gene Details

−

No NCBI Gene data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

ELISA

Enzyme-linked Immunosorbent Assay (EIA)

View Protocol

Find More Protocols