You have no items in your shopping cart.
Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)
SKU: orb1646259
Active
Description
Research Area
Infectious Disease & Virology; Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 g,ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 g,ml. |
| Tag | N-terminal GST-tagged |
| MW | 51.9 kD |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Tris-based buffer, 50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Regulator of cell morphogenesis and NO signaling

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active) (orb1646259)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review