You have no items in your shopping cart.
Active
Description
Images & Validation
−
Key Properties
−| Expression System | Escherichia coli |
|---|---|
| Biological Activity | Testing in progress. |
| Endotoxins | Less than 0.1 EU/ugof rHirudin as determined by LAL method. |
| Purity | > 96 % HPLC analyses. |
| Protein Sequence | LTVVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEP EEYL |
Storage & Handling
−| Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 °C as supplied.1 month, 2 to 8 °C under sterile conditions after reconstitution.3 months, -20 to -70 °C under sterile conditions after reconstitution. |
|---|---|
| Form/Appearance | Lyophilized from a 0.2 μm filtered solution of 20 mM PB, pH 7.0, containing 2 % mannitol. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Hirudin Protein [orb168498]
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Pichia Pastoris
10 μg, 1 mg, 2 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days